IL10RB MaxPab rabbit polyclonal antibody (D01)
  • IL10RB MaxPab rabbit polyclonal antibody (D01)

IL10RB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003588-D01
IL10RB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL10RB protein.
Información adicional
Size 100 uL
Gene Name IL10RB
Gene Alias CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene Description interleukin 10 receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL10RB (AAH01903.1, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3588

Enviar uma mensagem


IL10RB MaxPab rabbit polyclonal antibody (D01)

IL10RB MaxPab rabbit polyclonal antibody (D01)