IL10RB polyclonal antibody (A01)
  • IL10RB polyclonal antibody (A01)

IL10RB polyclonal antibody (A01)

Ref: AB-H00003588-A01
IL10RB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL10RB.
Información adicional
Size 50 uL
Gene Name IL10RB
Gene Alias CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene Description interleukin 10 receptor, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL10RB (NP_000619, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3588

Enviar uma mensagem


IL10RB polyclonal antibody (A01)

IL10RB polyclonal antibody (A01)