CXCR2 purified MaxPab mouse polyclonal antibody (B01P)
  • CXCR2 purified MaxPab mouse polyclonal antibody (B01P)

CXCR2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003579-B01P
CXCR2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CXCR2 protein.
Información adicional
Size 50 ug
Gene Name CXCR2
Gene Alias CD182|CDw128b|CMKAR2|IL8R2|IL8RA|IL8RB
Gene Description chemokine (C-X-C motif) receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXCR2 (NP_001548.1, 1 a.a. ~ 360 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3579

Enviar uma mensagem


CXCR2 purified MaxPab mouse polyclonal antibody (B01P)

CXCR2 purified MaxPab mouse polyclonal antibody (B01P)