IL6ST polyclonal antibody (A01)
  • IL6ST polyclonal antibody (A01)

IL6ST polyclonal antibody (A01)

Ref: AB-H00003572-A01
IL6ST polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL6ST.
Información adicional
Size 50 uL
Gene Name IL6ST
Gene Alias CD130|CDw130|GP130|GP130-RAPS|IL6R-beta
Gene Description interleukin 6 signal transducer (gp130, oncostatin M receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL6ST (NP_002175, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3572

Enviar uma mensagem


IL6ST polyclonal antibody (A01)

IL6ST polyclonal antibody (A01)