IL6R monoclonal antibody (M01), clone 2G6
  • IL6R monoclonal antibody (M01), clone 2G6

IL6R monoclonal antibody (M01), clone 2G6

Ref: AB-H00003570-M01
IL6R monoclonal antibody (M01), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL6R.
Información adicional
Size 100 ug
Gene Name IL6R
Gene Alias CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991
Gene Description interleukin 6 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL6R (NP_000556, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3570
Clone Number 2G6
Iso type IgG2b Kappa

Enviar uma mensagem


IL6R monoclonal antibody (M01), clone 2G6

IL6R monoclonal antibody (M01), clone 2G6