IL6R polyclonal antibody (A01)
  • IL6R polyclonal antibody (A01)

IL6R polyclonal antibody (A01)

Ref: AB-H00003570-A01
IL6R polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL6R.
Información adicional
Size 50 uL
Gene Name IL6R
Gene Alias CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991
Gene Description interleukin 6 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL6R (NP_000556, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3570

Enviar uma mensagem


IL6R polyclonal antibody (A01)

IL6R polyclonal antibody (A01)