IL6 monoclonal antibody (M14), clone 4H1
  • IL6 monoclonal antibody (M14), clone 4H1

IL6 monoclonal antibody (M14), clone 4H1

Ref: AB-H00003569-M14
IL6 monoclonal antibody (M14), clone 4H1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IL6.
Información adicional
Size 100 ug
Gene Name IL6
Gene Alias BSF2|HGF|HSF|IFNB2|IL-6
Gene Description interleukin 6 (interferon, beta 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL6 (AAH15511, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3569
Clone Number 4H1
Iso type IgG2a Kappa

Enviar uma mensagem


IL6 monoclonal antibody (M14), clone 4H1

IL6 monoclonal antibody (M14), clone 4H1