IL4R purified MaxPab mouse polyclonal antibody (B01P)
  • IL4R purified MaxPab mouse polyclonal antibody (B01P)

IL4R purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003566-B01P
IL4R purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL4R protein.
Información adicional
Size 50 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL4R (NP_001008699.1, 1 a.a. ~ 227 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3566

Enviar uma mensagem


IL4R purified MaxPab mouse polyclonal antibody (B01P)

IL4R purified MaxPab mouse polyclonal antibody (B01P)