IL3RA purified MaxPab mouse polyclonal antibody (B01P)
  • IL3RA purified MaxPab mouse polyclonal antibody (B01P)

IL3RA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003563-B01P
IL3RA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL3RA protein.
Información adicional
Size 50 ug
Gene Name IL3RA
Gene Alias CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra
Gene Description interleukin 3 receptor, alpha (low affinity)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL3RA (NP_002174.1, 1 a.a. ~ 378 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3563

Enviar uma mensagem


IL3RA purified MaxPab mouse polyclonal antibody (B01P)

IL3RA purified MaxPab mouse polyclonal antibody (B01P)