IL3 purified MaxPab mouse polyclonal antibody (B01P)
  • IL3 purified MaxPab mouse polyclonal antibody (B01P)

IL3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003562-B01P
IL3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL3 protein.
Información adicional
Size 50 ug
Gene Name IL3
Gene Alias IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF
Gene Description interleukin 3 (colony-stimulating factor, multiple)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL3 (AAH69472.1, 1 a.a. ~ 152 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3562

Enviar uma mensagem


IL3 purified MaxPab mouse polyclonal antibody (B01P)

IL3 purified MaxPab mouse polyclonal antibody (B01P)