IL2RG purified MaxPab mouse polyclonal antibody (B01P)
  • IL2RG purified MaxPab mouse polyclonal antibody (B01P)

IL2RG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003561-B01P
IL2RG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL2RG protein.
Información adicional
Size 50 ug
Gene Name IL2RG
Gene Alias CD132|IMD4|SCIDX|SCIDX1
Gene Description interleukin 2 receptor, gamma (severe combined immunodeficiency)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL2RG (NP_000197.1, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3561

Enviar uma mensagem


IL2RG purified MaxPab mouse polyclonal antibody (B01P)

IL2RG purified MaxPab mouse polyclonal antibody (B01P)