IL1RN purified MaxPab rabbit polyclonal antibody (D01P)
  • IL1RN purified MaxPab rabbit polyclonal antibody (D01P)

IL1RN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003557-D01P
IL1RN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL1RN protein.
Información adicional
Size 100 ug
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1RN (NP_776214.1, 1 a.a. ~ 177 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3557

Enviar uma mensagem


IL1RN purified MaxPab rabbit polyclonal antibody (D01P)

IL1RN purified MaxPab rabbit polyclonal antibody (D01P)