IL1A monoclonal antibody (M01), clone 4B8
  • IL1A monoclonal antibody (M01), clone 4B8

IL1A monoclonal antibody (M01), clone 4B8

Ref: AB-H00003552-M01
IL1A monoclonal antibody (M01), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL1A.
Información adicional
Size 100 ug
Gene Name IL1A
Gene Alias IL-1A|IL1|IL1-ALPHA|IL1F1
Gene Description interleukin 1, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL1A (AAH13142, 172 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3552
Clone Number 4B8
Iso type IgG1 Kappa

Enviar uma mensagem


IL1A monoclonal antibody (M01), clone 4B8

IL1A monoclonal antibody (M01), clone 4B8