IKBKB monoclonal antibody (M09), clone 2C3
  • IKBKB monoclonal antibody (M09), clone 2C3

IKBKB monoclonal antibody (M09), clone 2C3

Ref: AB-H00003551-M09
IKBKB monoclonal antibody (M09), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IKBKB.
Información adicional
Size 100 ug
Gene Name IKBKB
Gene Alias FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB
Gene Description inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IKBKB (AAH06231, 3 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3551
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


IKBKB monoclonal antibody (M09), clone 2C3

IKBKB monoclonal antibody (M09), clone 2C3