IHH monoclonal antibody (M01), clone 2G9
  • IHH monoclonal antibody (M01), clone 2G9

IHH monoclonal antibody (M01), clone 2G9

Ref: AB-H00003549-M01
IHH monoclonal antibody (M01), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant IHH.
Información adicional
Size 100 ug
Gene Name IHH
Gene Alias BDA1|HHG2
Gene Description Indian hedgehog homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IHH (AAH34757, 119 a.a. ~ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3549
Clone Number 2G9
Iso type IgG2a Kappa

Enviar uma mensagem


IHH monoclonal antibody (M01), clone 2G9

IHH monoclonal antibody (M01), clone 2G9