IGSF1 monoclonal antibody (M01), clone 4C7
  • IGSF1 monoclonal antibody (M01), clone 4C7

IGSF1 monoclonal antibody (M01), clone 4C7

Ref: AB-H00003547-M01
IGSF1 monoclonal antibody (M01), clone 4C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IGSF1.
Información adicional
Size 100 ug
Gene Name IGSF1
Gene Alias IGCD1|IGDC1|INHBP|KIAA0364|MGC75490|PGSF2
Gene Description immunoglobulin superfamily, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGSF1 (NP_001546, 220 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3547
Clone Number 4C7
Iso type IgG2a Kappa

Enviar uma mensagem


IGSF1 monoclonal antibody (M01), clone 4C7

IGSF1 monoclonal antibody (M01), clone 4C7