IGLL1 MaxPab mouse polyclonal antibody (B02P)
  • IGLL1 MaxPab mouse polyclonal antibody (B02P)

IGLL1 MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00003543-B02P
IGLL1 MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IGLL1 protein.
Información adicional
Size 50 ug
Gene Name IGLL1
Gene Alias 14.1|CD179b|IGL1|IGL5|IGLJ14.1|IGLL|IGO|IGVPB|VPREB2
Gene Description immunoglobulin lambda-like polypeptide 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGLL1 (NP_064455, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3543

Enviar uma mensagem


IGLL1 MaxPab mouse polyclonal antibody (B02P)

IGLL1 MaxPab mouse polyclonal antibody (B02P)