IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)

IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003500-D01P
IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGHG1 protein.
Información adicional
Size 100 ug
Gene Name IGHG1
Gene Alias -
Gene Description immunoglobulin heavy constant gamma 1 (G1m marker)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEFGLSWVFLVAILKGVQCEVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCATRGGYSTAGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGHG1 (AAH92518.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3500

Enviar uma mensagem


IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)

IGHG1 purified MaxPab rabbit polyclonal antibody (D01P)