IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)
  • IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)

IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003489-D01P
IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGFBP6 protein.
Información adicional
Size 100 ug
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGFBP6 (NP_002169.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3489

Enviar uma mensagem


IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)

IGFBP6 purified MaxPab rabbit polyclonal antibody (D01P)