IGBP1 monoclonal antibody (M01), clone 2B8
  • IGBP1 monoclonal antibody (M01), clone 2B8

IGBP1 monoclonal antibody (M01), clone 2B8

Ref: AB-H00003476-M01
IGBP1 monoclonal antibody (M01), clone 2B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IGBP1.
Información adicional
Size 100 ug
Gene Name IGBP1
Gene Alias ALPHA-4|IBP1
Gene Description immunoglobulin (CD79A) binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGBP1 (NP_001542, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3476
Clone Number 2B8
Iso type IgG1 Kappa

Enviar uma mensagem


IGBP1 monoclonal antibody (M01), clone 2B8

IGBP1 monoclonal antibody (M01), clone 2B8