IFNB1 polyclonal antibody (A01)
  • IFNB1 polyclonal antibody (A01)

IFNB1 polyclonal antibody (A01)

Ref: AB-H00003456-A01
IFNB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFNB1.
Información adicional
Size 50 uL
Gene Name IFNB1
Gene Alias IFB|IFF|IFNB|MGC96956
Gene Description interferon, beta 1, fibroblast
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNB1 (NP_002167, 102 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3456

Enviar uma mensagem


IFNB1 polyclonal antibody (A01)

IFNB1 polyclonal antibody (A01)