IFNA21 MaxPab rabbit polyclonal antibody (D01)
  • IFNA21 MaxPab rabbit polyclonal antibody (D01)

IFNA21 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003452-D01
IFNA21 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFNA21 protein.
Información adicional
Size 100 uL
Gene Name IFNA21
Gene Alias MGC126687|MGC126689
Gene Description interferon, alpha 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNA21 (AAH69329.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3452

Enviar uma mensagem


IFNA21 MaxPab rabbit polyclonal antibody (D01)

IFNA21 MaxPab rabbit polyclonal antibody (D01)