IFNA6 monoclonal antibody (M01), clone 3C9
  • IFNA6 monoclonal antibody (M01), clone 3C9

IFNA6 monoclonal antibody (M01), clone 3C9

Ref: AB-H00003443-M01
IFNA6 monoclonal antibody (M01), clone 3C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IFNA6.
Información adicional
Size 100 ug
Gene Name IFNA6
Gene Alias -
Gene Description interferon, alpha 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq WDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNA6 (NP_066282, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3443
Clone Number 3C9
Iso type IgG2a Kappa

Enviar uma mensagem


IFNA6 monoclonal antibody (M01), clone 3C9

IFNA6 monoclonal antibody (M01), clone 3C9