IFNA1 polyclonal antibody (A01)
  • IFNA1 polyclonal antibody (A01)

IFNA1 polyclonal antibody (A01)

Ref: AB-H00003439-A01
IFNA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFNA1.
Información adicional
Size 50 uL
Gene Name IFNA1
Gene Alias IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507
Gene Description interferon, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNA1 (NP_076918, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3439

Enviar uma mensagem


IFNA1 polyclonal antibody (A01)

IFNA1 polyclonal antibody (A01)