SP110 monoclonal antibody (M04), clone 4B8
  • SP110 monoclonal antibody (M04), clone 4B8

SP110 monoclonal antibody (M04), clone 4B8

Ref: AB-H00003431-M04
SP110 monoclonal antibody (M04), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP110.
Información adicional
Size 100 ug
Gene Name SP110
Gene Alias FLJ22835|IFI41|IFI75|IPR1|VODI
Gene Description SP110 nuclear body protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP110 (NP_004501, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3431
Clone Number 4B8
Iso type IgG2a Kappa

Enviar uma mensagem


SP110 monoclonal antibody (M04), clone 4B8

SP110 monoclonal antibody (M04), clone 4B8