IFI35 polyclonal antibody (A01)
  • IFI35 polyclonal antibody (A01)

IFI35 polyclonal antibody (A01)

Ref: AB-H00003430-A01
IFI35 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFI35.
Información adicional
Size 50 uL
Gene Name IFI35
Gene Alias FLJ21753|IFP35
Gene Description interferon-induced protein 35
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFI35 (NP_005524, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3430

Enviar uma mensagem


IFI35 polyclonal antibody (A01)

IFI35 polyclonal antibody (A01)