IFI27 polyclonal antibody (A01)
  • IFI27 polyclonal antibody (A01)

IFI27 polyclonal antibody (A01)

Ref: AB-H00003429-A01
IFI27 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IFI27.
Información adicional
Size 50 uL
Gene Name IFI27
Gene Alias FAM14D|ISG12|ISG12A|P27
Gene Description interferon, alpha-inducible protein 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFI27 (AAH15492, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3429

Enviar uma mensagem


IFI27 polyclonal antibody (A01)

IFI27 polyclonal antibody (A01)