CFI purified MaxPab rabbit polyclonal antibody (D01P)
  • CFI purified MaxPab rabbit polyclonal antibody (D01P)

CFI purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003426-D01P
CFI purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CFI protein.
Información adicional
Size 100 ug
Gene Name CFI
Gene Alias C3B-INA|FI|IF|KAF
Gene Description complement factor I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CFI (AAH20718.1, 1 a.a. ~ 377 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3426

Enviar uma mensagem


CFI purified MaxPab rabbit polyclonal antibody (D01P)

CFI purified MaxPab rabbit polyclonal antibody (D01P)