IF polyclonal antibody (A01)
  • IF polyclonal antibody (A01)

IF polyclonal antibody (A01)

Ref: AB-H00003426-A01
IF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IF.
Información adicional
Size 50 uL
Gene Name CFI
Gene Alias C3B-INA|FI|IF|KAF
Gene Description complement factor I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IF (NP_000195, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3426

Enviar uma mensagem


IF polyclonal antibody (A01)

IF polyclonal antibody (A01)