IDI1 purified MaxPab rabbit polyclonal antibody (D01P)
  • IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003422-D01P
IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IDI1 protein.
Información adicional
Size 100 ug
Gene Name IDI1
Gene Alias IPP1|IPPI1
Gene Description isopentenyl-diphosphate delta isomerase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDI1 (AAH57827.1, 1 a.a. ~ 228 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3422

Enviar uma mensagem


IDI1 purified MaxPab rabbit polyclonal antibody (D01P)

IDI1 purified MaxPab rabbit polyclonal antibody (D01P)