IDH3G purified MaxPab rabbit polyclonal antibody (D01P)
  • IDH3G purified MaxPab rabbit polyclonal antibody (D01P)

IDH3G purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003421-D01P
IDH3G purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IDH3G protein.
Información adicional
Size 100 ug
Gene Name IDH3G
Gene Alias H-IDHG
Gene Description isocitrate dehydrogenase 3 (NAD+) gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDH3G (NP_004126.1, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3421

Enviar uma mensagem


IDH3G purified MaxPab rabbit polyclonal antibody (D01P)

IDH3G purified MaxPab rabbit polyclonal antibody (D01P)