IDH3B monoclonal antibody (M01), clone 3A10
  • IDH3B monoclonal antibody (M01), clone 3A10

IDH3B monoclonal antibody (M01), clone 3A10

Ref: AB-H00003420-M01
IDH3B monoclonal antibody (M01), clone 3A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IDH3B.
Información adicional
Size 100 ug
Gene Name IDH3B
Gene Alias FLJ11043|H-IDHB|MGC903
Gene Description isocitrate dehydrogenase 3 (NAD+) beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3420
Clone Number 3A10
Iso type IgG3 Kappa

Enviar uma mensagem


IDH3B monoclonal antibody (M01), clone 3A10

IDH3B monoclonal antibody (M01), clone 3A10