IDH3A purified MaxPab mouse polyclonal antibody (B01P)
  • IDH3A purified MaxPab mouse polyclonal antibody (B01P)

IDH3A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003419-B01P
IDH3A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IDH3A protein.
Información adicional
Size 50 ug
Gene Name IDH3A
Gene Alias -
Gene Description isocitrate dehydrogenase 3 (NAD+) alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDH3A (NP_005521.1, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3419

Enviar uma mensagem


IDH3A purified MaxPab mouse polyclonal antibody (B01P)

IDH3A purified MaxPab mouse polyclonal antibody (B01P)