ID4 monoclonal antibody (M13), clone 3F11
  • ID4 monoclonal antibody (M13), clone 3F11

ID4 monoclonal antibody (M13), clone 3F11

Ref: AB-H00003400-M13
ID4 monoclonal antibody (M13), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ID4.
Información adicional
Size 100 ug
Gene Name ID4
Gene Alias IDB4|bHLHb27
Gene Description inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID4 (NP_001537.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3400
Clone Number 3F11
Iso type IgG2a Kappa

Enviar uma mensagem


ID4 monoclonal antibody (M13), clone 3F11

ID4 monoclonal antibody (M13), clone 3F11