ID3 monoclonal antibody (M04), clone 3D3
  • ID3 monoclonal antibody (M04), clone 3D3

ID3 monoclonal antibody (M04), clone 3D3

Ref: AB-H00003399-M04
ID3 monoclonal antibody (M04), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ID3.
Información adicional
Size 100 ug
Gene Name ID3
Gene Alias HEIR-1|bHLHb25
Gene Description inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3399
Clone Number 3D3
Iso type IgG2a Kappa

Enviar uma mensagem


ID3 monoclonal antibody (M04), clone 3D3

ID3 monoclonal antibody (M04), clone 3D3