ID3 monoclonal antibody (M02), clone 3E10
  • ID3 monoclonal antibody (M02), clone 3E10

ID3 monoclonal antibody (M02), clone 3E10

Ref: AB-H00003399-M02
ID3 monoclonal antibody (M02), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ID3.
Información adicional
Size 100 ug
Gene Name ID3
Gene Alias HEIR-1|bHLHb25
Gene Description inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3399
Clone Number 3E10
Iso type IgG3 Kappa

Enviar uma mensagem


ID3 monoclonal antibody (M02), clone 3E10

ID3 monoclonal antibody (M02), clone 3E10