ID3 purified MaxPab mouse polyclonal antibody (B01P)
  • ID3 purified MaxPab mouse polyclonal antibody (B01P)

ID3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003399-B01P
ID3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ID3 protein.
Información adicional
Size 50 ug
Gene Name ID3
Gene Alias HEIR-1|bHLHb25
Gene Description inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ID3 (AAH03107.1, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3399

Enviar uma mensagem


ID3 purified MaxPab mouse polyclonal antibody (B01P)

ID3 purified MaxPab mouse polyclonal antibody (B01P)