ID2 monoclonal antibody (M04), clone 2C11
  • ID2 monoclonal antibody (M04), clone 2C11

ID2 monoclonal antibody (M04), clone 2C11

Ref: AB-H00003398-M04
ID2 monoclonal antibody (M04), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ID2.
Información adicional
Size 100 ug
Gene Name ID2
Gene Alias GIG8|ID2A|ID2H|MGC26389|bHLHb26
Gene Description inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3398
Clone Number 2C11
Iso type IgG2a Kappa

Enviar uma mensagem


ID2 monoclonal antibody (M04), clone 2C11

ID2 monoclonal antibody (M04), clone 2C11