ID2 polyclonal antibody (A01)
  • ID2 polyclonal antibody (A01)

ID2 polyclonal antibody (A01)

Ref: AB-H00003398-A01
ID2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ID2.
Información adicional
Size 50 uL
Gene Name ID2
Gene Alias GIG8|ID2A|ID2H|MGC26389|bHLHb26
Gene Description inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3398

Enviar uma mensagem


ID2 polyclonal antibody (A01)

ID2 polyclonal antibody (A01)