ID1 monoclonal antibody (M10), clone 3A9
  • ID1 monoclonal antibody (M10), clone 3A9

ID1 monoclonal antibody (M10), clone 3A9

Ref: AB-H00003397-M10
ID1 monoclonal antibody (M10), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ID1.
Información adicional
Size 100 ug
Gene Name ID1
Gene Alias ID|bHLHb24
Gene Description inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3397
Clone Number 3A9
Iso type IgG2a Kappa

Enviar uma mensagem


ID1 monoclonal antibody (M10), clone 3A9

ID1 monoclonal antibody (M10), clone 3A9