ICA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ICA1 purified MaxPab rabbit polyclonal antibody (D01P)

ICA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003382-D01P
ICA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ICA1 protein.
Información adicional
Size 100 ug
Gene Name ICA1
Gene Alias ICA69|ICAp69
Gene Description islet cell autoantigen 1, 69kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ICA1 (AAH08640.1, 1 a.a. ~ 482 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3382

Enviar uma mensagem


ICA1 purified MaxPab rabbit polyclonal antibody (D01P)

ICA1 purified MaxPab rabbit polyclonal antibody (D01P)