ICA1 polyclonal antibody (A01)
  • ICA1 polyclonal antibody (A01)

ICA1 polyclonal antibody (A01)

Ref: AB-H00003382-A01
ICA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ICA1.
Información adicional
Size 50 uL
Gene Name ICA1
Gene Alias ICA69|ICAp69
Gene Description islet cell autoantigen 1, 69kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICA1 (NP_071682, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3382

Enviar uma mensagem


ICA1 polyclonal antibody (A01)

ICA1 polyclonal antibody (A01)