HYAL1 monoclonal antibody (M01), clone 2H7
  • HYAL1 monoclonal antibody (M01), clone 2H7

HYAL1 monoclonal antibody (M01), clone 2H7

Ref: AB-H00003373-M01
HYAL1 monoclonal antibody (M01), clone 2H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HYAL1.
Información adicional
Size 100 ug
Gene Name HYAL1
Gene Alias HYAL-1|LUCA1|MGC45987|NAT6
Gene Description hyaluronoglucosaminidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3373
Clone Number 2H7
Iso type IgG2a Kappa

Enviar uma mensagem


HYAL1 monoclonal antibody (M01), clone 2H7

HYAL1 monoclonal antibody (M01), clone 2H7