View larger
Mouse monoclonal antibody raised against a partial recombinant HYAL1.
AB-H00003373-M01
New product
HYAL1 monoclonal antibody (M01), clone 2H7
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | HYAL1 |
| Gene Alias | HYAL-1|LUCA1|MGC45987|NAT6 |
| Gene Description | hyaluronoglucosaminidase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3373 |
| Clone Number | 2H7 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant HYAL1.