HYAL1 polyclonal antibody (A01)
  • HYAL1 polyclonal antibody (A01)

HYAL1 polyclonal antibody (A01)

Ref: AB-H00003373-A01
HYAL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HYAL1.
Información adicional
Size 50 uL
Gene Name HYAL1
Gene Alias HYAL-1|LUCA1|MGC45987|NAT6
Gene Description hyaluronoglucosaminidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL1 (NP_009296, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3373

Enviar uma mensagem


HYAL1 polyclonal antibody (A01)

HYAL1 polyclonal antibody (A01)