HTR5A monoclonal antibody (M02), clone 3D1
  • HTR5A monoclonal antibody (M02), clone 3D1

HTR5A monoclonal antibody (M02), clone 3D1

Ref: AB-H00003361-M02
HTR5A monoclonal antibody (M02), clone 3D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR5A.
Información adicional
Size 100 ug
Gene Name HTR5A
Gene Alias 5-HT5A|MGC138226
Gene Description 5-hydroxytryptamine (serotonin) receptor 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3361
Clone Number 3D1
Iso type IgG2a Kappa

Enviar uma mensagem


HTR5A monoclonal antibody (M02), clone 3D1

HTR5A monoclonal antibody (M02), clone 3D1