HTR2C monoclonal antibody (M02), clone 1A8
  • HTR2C monoclonal antibody (M02), clone 1A8

HTR2C monoclonal antibody (M02), clone 1A8

Ref: AB-H00003358-M02
HTR2C monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR2C.
Información adicional
Size 100 ug
Gene Name HTR2C
Gene Alias 5-HT2C|5-HTR2C|HTR1C
Gene Description 5-hydroxytryptamine (serotonin) receptor 2C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR2C (NP_000859, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3358
Clone Number 1A8
Iso type IgG2a Kappa

Enviar uma mensagem


HTR2C monoclonal antibody (M02), clone 1A8

HTR2C monoclonal antibody (M02), clone 1A8