HTR2C polyclonal antibody (A01)
  • HTR2C polyclonal antibody (A01)

HTR2C polyclonal antibody (A01)

Ref: AB-H00003358-A01
HTR2C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HTR2C.
Información adicional
Size 50 uL
Gene Name HTR2C
Gene Alias 5-HT2C|5-HTR2C|HTR1C
Gene Description 5-hydroxytryptamine (serotonin) receptor 2C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR2C (NP_000859, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3358

Enviar uma mensagem


HTR2C polyclonal antibody (A01)

HTR2C polyclonal antibody (A01)