HTR2B monoclonal antibody (M09), clone 4F3
  • HTR2B monoclonal antibody (M09), clone 4F3

HTR2B monoclonal antibody (M09), clone 4F3

Ref: AB-H00003357-M09
HTR2B monoclonal antibody (M09), clone 4F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR2B.
Información adicional
Size 100 ug
Gene Name HTR2B
Gene Alias 5-HT(2B)|5-HT2B
Gene Description 5-hydroxytryptamine (serotonin) receptor 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR2B (AAH63123.1, 199 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3357
Clone Number 4F3
Iso type IgG2b Kappa

Enviar uma mensagem


HTR2B monoclonal antibody (M09), clone 4F3

HTR2B monoclonal antibody (M09), clone 4F3