HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003329-D01P
HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPD1 protein.
Información adicional
Size 100 ug
Gene Name HSPD1
Gene Alias CPN60|GROEL|HLD4|HSP60|HSP65|HuCHA60|SPG13
Gene Description heat shock 60kDa protein 1 (chaperonin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPD1 (NP_002147.2, 1 a.a. ~ 573 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3329

Enviar uma mensagem


HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPD1 purified MaxPab rabbit polyclonal antibody (D01P)