HSPA9 purified MaxPab mouse polyclonal antibody (B01P)
  • HSPA9 purified MaxPab mouse polyclonal antibody (B01P)

HSPA9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003313-B01P
HSPA9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HSPA9 protein.
Información adicional
Size 50 ug
Gene Name HSPA9
Gene Alias CSA|GRP75|HSPA9B|MGC4500|MOT|MOT2|MTHSP75|PBP74|mot-2
Gene Description heat shock 70kDa protein 9 (mortalin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPA9 (AAH00478.1, 1 a.a. ~ 679 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3313

Enviar uma mensagem


HSPA9 purified MaxPab mouse polyclonal antibody (B01P)

HSPA9 purified MaxPab mouse polyclonal antibody (B01P)